118

ASAH1 Blocking Peptide | 33R-7724

(No reviews yet) Write a Review
SKU:
118-33R-7724-GEN
Availability:
Usually ships in 5 working days
NULL376.00

Description

ASAH1 Blocking Peptide | 33R-7724 |

Activity Code: ACTIVE

Product Type: Proteins

Research Area: Signal Transduction

Short Description: A synthetic peptide for use as a blocking control in assays to test for specificity of ASAH1 antibody, catalog no. 70R-5484

Immunogen: N/A

Host: N/A

Specificity: N/A

Cross Reactivity: N/A

Isotype: N/A

IClone: N/A

Species: N/A

Residues: QSGEGCVITRDRKESLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTP

Tag/conjugate: N/A

Protein Type: Synthetic

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: N/A

Source: N/A

Concentration: N/A

Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage: Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB, IHC

Bioactivity: N/A

View AllClose

Additional Information

Size:
100 ug
View AllClose