Blue Fluorescent Protein (BFP) | 4994

The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

4994 | Blue Fluorescent Protein BFP DataSheet

Biomolecule/Target: N/A

Synonyms: BFP, Blue Fluorescent Protein

Alternates names: Fatty acid-binding protein adipocyte, AFABP, Fatty acid-binding protein 4, Adipocyte lipid-binding protein, ALBP, A-FABP, FABP4.

Taglines: Fluorescent protein ideal for subcellular labeling/visualization

NCBI Gene ID #: 2167

NCBI Gene Symbol: FABP4

Gene Source: N/A

Accession #: P15090

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 98%

Assay: SDS-PAGE

Purity: 97%

Assay #2: HPLC

Endotoxin Level: <0.1 ng/g

Activity (Specifications/test method): N/A

Biological activity: Test in process

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 16 kDa

Concentration: N/A

Appearance: Lyophilized protein

Physical form description: Freeze Dried

Reconstitution Instructions: Reconstitute in HO to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers

Amino acid sequence: N/A