C17ORF64 antibody | 70R-3321

C17ORF64 antibody | 70R-3321 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Immunology

Short Description: Rabbit polyclonal C17ORF64 antibody raised against the middle region of C17Orf64

Immunogen: C17ORF64 antibody was raised using the middle region of C17Orf64 corresponding to a region with amino acids NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE

Host: Rabbit

Specificity: C17ORF64 antibody was raised against the middle region of C17Orf64

Cross Reactivity: Human

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Affinity purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB

Bioactivity: N/A

Usage Recommendations: WB: 1 ug/ml

Assay Information: C17ORF64 Blocking Peptide, catalog no. 33R-6799, is also available for use as a blocking control in assays to test for specificity of this C17ORF64 antibody