C5a (His-Tag), murine recombinant | 4895A

Mouse complement C5a is a 77-amino acid peptide generated during complement activation from the -chain of complement C5. Mouse C5a shares 60% and 82% amino acid sequence identity to human and rat C5a, respectively. C5a binds to a signaling G-protein coupled receptor (GPCR) (C5aR/CD88), inducing neutrophil chemotaxis and endothelial cell activation. It also triggers an oxidative burst in macrophages and neutrophils, and induces release of histamine in basophils and mast cells. The 9 kDa mouse C5a protein expressed in E. coli contains a N-terminal His-Tag sequence.

4895A | C5a His-Tag murine recombinant DataSheet

Biomolecule/Target: N/A

Synonyms: Complement Fragments C5a

Alternates names: CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin

Taglines: An anaphylatoxin

NCBI Gene ID #: Mm.225297

NCBI Gene Symbol: ENG

Gene Source: Mouse

Accession #: Q63961

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 95%

Assay: SDS-PAGE

Purity: N/A

Assay #2: HPLC

Endotoxin Level: <0.1 ng/g

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: 1-3 nmolar

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 75-85 kDa

Concentration: N/A

Appearance: Lyophilized protein

Physical form description: Sterile filtered and lyophilized with no additives

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile PBS to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS