C5a, human recombinant | 4995B

Human complement C5a is a 74-amino acid glycopeptide generated during complement activation from the -chain of complement C5. C5a is a potent chemotactic factor for human peripheral blood neutrophils and monocytes, and is believed to play an important role in a number of inflammatory conditions. The 74 amino acid, human C5a protein expressed in E. coli has an activity similar to that of serum derived C5a based on enzyme assay of myeloperoxidase release.

4995B | C5a human recombinant DataSheet

Biomolecule/Target: N/A

Synonyms: Recombinant human C5a

Alternates names: CD105, ENG, END, ORW, HHT1, ORW1, FLJ41744, Endoglin

Taglines: A potent chemotactic factor for human peripheral blood neutrophils and monocytes

NCBI Gene ID #: Mm.225297

NCBI Gene Symbol: ENG

Gene Source: N/A

Accession #: Q63961

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 95%

Assay: SDS-PAGE

Purity: N/A

Assay #2: HPLC

Endotoxin Level: <0.1 ng/g

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 75-85 kDa

Concentration: N/A

Appearance: Lyophilized protein

Physical form description: Lyophilized with no additives

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile PBS to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFVELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMTLALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVVSNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQVSVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSFLLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS