367
E2F1 Antibody BIOTIN | 292-E2F1n-BIOTIN
- SKU:
- 292-E2F1n-BIOTIN-GEN
- Availability:
- 5 to 7 Days Shipment
Description
E2F1 Antibody BIOTIN | 292-E2F1n-BIOTIN from FabGennix.
View AllClose
Product Type: BIOTIN-Conjugated
Reactivity: Human/Mouse/Rat
Application: ELISA, WB
Purity: Affinity Purified
Conjugate/Tag/Label: BIOTIN
Target: E2F1
Immunogen: Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Domain/Region/Terminus: N-epitope
Host: Rabbit
Isotype: IgG
Clonality: Polyclonal