FAM54A antibody | 70R-3511

FAM54A antibody | 70R-3511 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Nutrition & Metabolism

Short Description: Rabbit polyclonal FAM54A antibody raised against the middle region of FAM54A

Immunogen: FAM54A antibody was raised using the middle region of FAM54A corresponding to a region with amino acids NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ

Host: Rabbit

Specificity: FAM54A antibody was raised against the middle region of FAM54A

Cross Reactivity: Human

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Affinity purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB

Bioactivity: N/A

Usage Recommendations: WB: 1 ug/ml

Assay Information: FAM54A Blocking Peptide, catalog no. 33R-6748, is also available for use as a blocking control in assays to test for specificity of this FAM54A antibody