Description
FGF13 antibody | 70R-6208 |
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Neuroscience
Short Description: Rabbit polyclonal FGF13 antibody raised against the middle region of FGF13
Immunogen: FGF13 antibody was raised using the middle region of FGF13 corresponding to a region with amino acids TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTK
Host: Rabbit
Specificity: FGF13 antibody was raised against the middle region of FGF13
Cross Reactivity: Human, Mouse, Rat
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Affinity purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1 ug/ml
Assay Information: FGF13 Blocking Peptide, catalog no. 33R-9144, is also available for use as a blocking control in assays to test for specificity of this FGF13 antibody