Human CellExp™ CHI3L3, Mouse Recombinant | P1312

Chitinase 3-like 3 gene, also known as YM1 and ECF-L, encodes a precursor protein with 398 amino acid residues with a 21 residue signal sequence. Chitinase 3-like 3 protein is a lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine. Binding to oligomeric saccharides is much stronger than binding to mono- or disaccharides. Also binds heparin and G1cN oligomers, and is produced primarily by macrophages during inflammation. It has chemotactic activity for T-lymphocytes, bone marrow cells and eosinophils.

P1312 | Human CellExp CHI3L3 Mouse Recombinant DataSheet

Biomolecule/Target: CHI3L3

Synonyms: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3

Alternates names: Chitinase-Like Protein 3, YM1/ECF-L, CHI3L3

Taglines: Lectin that binds saccharides with a free amino group, such as glucosamine or galactosamine.

NCBI Gene ID #: 15978

NCBI Gene Symbol: IFNG

Gene Source: Mouse

Accession #: P01580

Recombinant: Yes

Source: HEK 293 cells

Purity by SDS-PAGEs: 95%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: N/A

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: N/A

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from a 0.2 m filtered solution of PBS, pH7.4.

Reconstitution Instructions: Reconstitute in sterile deionized water to a concentration of 100 µg/ml.

Amino acid sequence: YQLMCYYTSWAKDRPIEGSFKPGNIDPCLCTHLIYAFAGMQNNEITYTHEQDLRDYEALNGLKDKNTELKTLLAIGGWKFGPAS FSAMVSTPQNRQIFIQSVIRFLRQYNFDGLNLDWQYPGSRGSPPKDKHLFSVLVKEMRKAFEEESVEKDIPRLLLTSTGAGIIDVI KSGYKIPELSQSLDYIQVMTYDLHDPKDGYTGENSPLYKSPYDIGKSADLNVDSIISYWKDHGAASEKLIVGFPAYGHTFILSDPSK TGIGAPTISTGPPGKYTDESGLLAYYEVCTFLNEGATEVWDAPQEVPYAYQGNEWVGYDNVRSFKLKAQWLKDNNLGGAVVWPLDMDDFSGSFCHQRHFPLTSTLKGDLNIHSASCKGPYVDHHHHHH