26

Human CellExp™ Human CD40/ TNFRSF5, Human recombinant | 9230

(No reviews yet) Write a Review
SKU:
26-9230-GEN
Availability:
Usually shipped in 5 working days
zł3,162.00 - zł7,194.00

Description

Tumor necrosis factor receptor superfamily member 5 (TNFRSF5) is also known as CD40, is a member of the TNF receptor superfamily. The expression of CD40 is diverse. TNFRSF5 has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of immunodeficiency with hyper-IgM type 3 (HIGM3).

9230 | Human CellExp Human CD40/ TNFRSF5 Human recombinant DataSheet

Biomolecule/Target: CD40

Synonyms: CD40, Bp50, CDW40, MGC9013, TNFRSF5, p50

Alternates names: Glia maturation factor gamma, GMF-gamma, GMFG, MGC126867

Taglines: Tumor necrosis factor receptor superfamily member 5

NCBI Gene ID #: 9535

NCBI Gene Symbol: GMFG

Gene Source: Human

Accession #: O60234

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 90%

Assay: SDS-PAGE

Purity: >95%

Assay #2: N/A

Endotoxin Level: < 1 EU/g

Activity (Specifications/test method): Measured by its binding ability in a functional ELISA.

Biological activity: N/A

Results: N/A

Binding Capacity: Immobilized Human CD40, His Tag at 1 µg/mL (100 µL/well) can bind Human CD40 Ligand /TNFSF5 with a linear range of 0.01-0.12 ng/mL.

Unit Definition: N/A

Molecular Weight: 16.8 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in PBS, pH 7.4. Normally Mannitol or Trehalose is added as protectants before lyophilization.

Reconstitution Instructions: N/A

Amino acid sequence: MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose