Human CellExp™ LILRB3 / CD85a / ILT5, Human Recombinant | P1204

Leukocyte immunoglobulin-like receptor subfamily B member 3 is also known as LILRB3,ILT-5 or CD85a. LILRB3 plays an role as receptor for class I MHC antigens, which activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. LILRB3 and LILRA6 represent a pair of inhibitory/activating receptors with identical extracellular domains and unknown ligands. LILRB3 can mediate inhibitory signaling via immunoreceptor tyrosine-based inhibition motifs in its cytoplasmic tail whereas LILRA6 can signal through association with an activating adaptor molecule, FcR.

P1204 | Human CellExp LILRB3 / CD85a / ILT5 Human Recombinant DataSheet

Biomolecule/Target: LILRB3

Synonyms: LILRB3, CD85a, ILT5

Alternates names: Leukemia Inhibitory Factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor, INN=Emfilermin

Taglines: Receptor for class I MHC antigens

NCBI Gene ID #: 16878

NCBI Gene Symbol: LIF

Gene Source: Mouse

Accession #: Q3U1H5

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 95%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: < 1.0 EU per/g

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 20.0 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in PBS, pH7.4. Generally Mannitol or Trehalose is added as a protectant before lyophilization.

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF