Description
Human HLA-E protein | orb246489
Conjugation | Unconjugated |
---|---|
Target | HLA-E |
Alternative Names | (click to expand) |
Form/Appearance | Liquid or Lyophilized powder |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Tag | N-terminal 6xHis-SUMO-tagged |
Note | For research use only. |
Protein Sequence | GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 48.7 kDa |
Source | E.coli |
Expression Region | 22-305aa |
Uniprot ID | P13747 |
Application Notes | Full length of Alpha-1 and Alpha-2 and Alpha-3 of His-SUMO-tag and expression region is 22-305aa |
Description | Recombinant human HLA class I histocompatibility antigen, alpha chain E |