118

Lipase antibody (Pancreatic) | 70R-1583

(No reviews yet) Write a Review
SKU:
118-70R-1583-GEN
Availability:
Usually ships in 5 working days
zł4,410.00

Description

Lipase antibody (Pancreatic) | 70R-1583 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Signal Transduction

Short Description: Rabbit polyclonal Lipase antibody (Pancreatic) raised against the C terminal of PNLIP

Immunogen: Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

Host: Rabbit

Specificity: Lipase antibody (Pancreatic) was raised against the C terminal of PNLIP

Cross Reactivity: Human

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Total IgG Protein A purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB

Bioactivity: N/A

Usage Recommendations: WB: 1.25 ug/ml

Assay Information: Lipase Blocking Peptide (Pancreatic), catalog no. 33R-8469, is also available for use as a blocking control in assays to test for specificity of this Lipase antibody (Pancreatic)

View AllClose

Additional Information

Size:
100 uL
View AllClose