Description
PIGF1 protein | 30R-AP036 |
Activity Code: ACTIVE
Product Type: Proteins
Product Subtype: Recombinant Proteins
Research Area: Cytokines & Growth Factors
Short Description: Purified recombinant Human PIGF1 protein
Immunogen: N/A
Host: N/A
Specificity: N/A
Cross Reactivity: N/A
Isotype: N/A
IClone: N/A
Species: Human
Residues: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERCGDAVPRR
Tag/conjugate: N/A
Protein Type: Binding Protein
Expression System: Sf-9 insect cells
Grade & Purity: > 90% pure
Methode of Purification: N/A
Source: N/A
Concentration: N/A
Form & Buffer: Lyophilized with carrier-protein (HSA) and can be reconstituted with 50 mM acetic acid or PBS.
Storage: Store at -20 deg C until reconstitution. Following reconstitution product may be stored at 4 deg C in the short term. For long term storage aliquot and freeze at -20 deg C. Avoid repeated freeze/thaw cycles.
Shipping Information: *Blue Ice*
Applications: User optimized
Bioactivity: N/A
Usage Recommendations: N/A
Assay Information: N/A