Recombinant Human Activin-B Protein [Insect cells] | 100-330S/100-330

Recombinant Human Activin-B Protein [Insect cells] | 100-330S/100-330 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: Insect cells

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: INHBB, Inhibin beta-2, Activin beta-B

Isotype: N/A

Application: N/A

Detection Range: The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is ≤ 2.0 ng/ml, corresponding to a specific activity of ≥ 5 x 105 units/mg.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: Activin B is a TGF-β family member that exhibits a wide range of biological activities including regulation of embryogenesis, osteogenesis, hematopoiesis, reproductive physiology and hormone secretion from the hypothalamic, pituitary and gonadal glands. Activin B, like certain other members of the TGF-β family, signals through the ActRII receptor (Activin Receptor type II). Human Activin B is a 25.6 kDa disulfide-linked homodimer consisting of two βB chains, each containing 115 amino acid residues.

Purity Confirmation: > 95% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 25.6 kDa

Lenght (aa): 115

Protein Sequence: GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA

NCBI Gene ID: 3625