209
Recombinant Human BMP receptor-1A, soluble Protein [Insect cells] | S01-021
- SKU:
- 209-S01-021-GEN
Description
Recombinant Human BMP receptor-1A, soluble Protein [Insect cells] | S01-021 | Gentaur UK, US & Europe Distribution
Species: Human
Host / biotech: Insect cells
Comment: N/A
Label: His-Tag
Clone / Antibody feature: N/A
Subcategory: Soluble Receptors
Category: Recombinant Protein
Synonyms: ALK3; SKR5; CD292; ACVRLK3; 10q23del; bone morphogenetic protein receptor, type IA
Isotype: N/A
Application: N/A
Detection Range: Measured by its ability to inhibit recombinant human BMP-2 induced alkaline phosphatase production by C2C12 myogenic cells. The ED50 for this effect is typically 1-3 µg/ml in the presence of 500 ng/ml of recombinant human BMP-2.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: The extracellular domain of human BMPR-IA was fused with a carboxy-terminal 6X histidine-tag. The monomeric glycoprotein was expressed in baculovirus infected insect cells. Cellular responses to bone morphogenetic proteins (BMPs) have been shown to be mediated by the formation of hetero-oligomeric complexes of the type I and type II serine/threonine kinase receptors. BMP receptor 1A (BMPR-1A), also known as activin receptor-like kinase (ALK)-3, is a one of seven known type I serine/threonine kinases that are required for the signal transduction of TGF-b family cytokines. In contrast to the TGF-b receptor system in which the type I receptor does not bind TGF-b in the absence of the type II receptor, type I receptors involved in BMP signaling (including BMPR-IA, BMPR-IB/ALK-6, and ActR-I/ALK-2) can independently bind the various BMP family proteins in the absence of type II receptors. Recombinant soluble BMPR-IA binds BMP-2 and -4 with high-affinity in solution and is a potent BMP-2/4 antagonist in vitro. BMPR-IA is ubiquitously expressed during embryogenesis. In adult tissues, BMPR-IA mRNA is also widely distributed; with the highest expression levels found in skeletal muscle. The extracellular domain of BMPR-IA shares little amino acid sequence identity with the other mammalian ALK type I receptor kinases, but the cysteine residues are conserved. Human and mouse BMPR-IA are highly conserved and share 98% sequence identity.
Purity Confirmation: > 90% by SDS-PAGE
Endotoxin: N/A
Formulation: lyophilized
Storage Handling Stability: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sBMPR-1A should be stored in working aliquots at -20°C.
Reconstituation: The lyophilized sBMPR-1A is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
Molecular Weight: 23 kDa
Lenght (aa): 135
Protein Sequence: QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRHHHHHH
NCBI Gene ID: 657