209

Recombinant Human Endomucin Protein [E. coli] | S01-064

(No reviews yet) Write a Review
SKU:
209-S01-064-GEN
NULL731.00

Description

Recombinant Human Endomucin Protein [E. coli] | S01-064 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: His-Tag

Clone / Antibody feature: N/A

Subcategory: Soluble Receptors

Category: Recombinant Protein

Synonyms: Endomucin-2, Gastric cancer antigen Ga34, Mucin-14

Isotype: N/A

Application: N/A

Detection Range: Data not available.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively.

Purity Confirmation: > 95% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.

Reconstituation: The lyophilized human soluble Endomucin is soluble in water and most aqueous buffers; it should be reconstituted in water or PBS to a concentration of not lower than 100 µg/ml.

Molecular Weight: 20.4 kDa

Lenght (aa): 197

Protein Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS

NCBI Gene ID: 51705

View AllClose

Additional Information

Size:
20 μg
View AllClose