Recombinant Human IL-4 Protein [E. coli] | 200-021/200-022/200-023-DC

Recombinant Human IL-4 Protein [E. coli] | 200-021/200-022/200-023-DC | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: IL4; BSF1; IL-4; BCGF1; BSF-1; BCGF-1

Isotype: N/A

Application: N/A

Detection Range: The ED50 as determined by the dose-dependent stimulation of human TF-1 cells is 0.1-0.5ng/ml.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 14.9 kDa globular protein containing 130 amino acid residues

Purity Confirmation: > 98% by SDS-PAGE

Endotoxin: < 0.1 ng per µg of IL-4

Formulation: lyophilized

Storage Handling Stability: The lyophilized IL-4, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.

Reconstituation: The lyophilized IL-4 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.

Molecular Weight: 14.9 kDa

Lenght (aa): 130

Protein Sequence: MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

NCBI Gene ID: 3565