Recombinant Human IL-6 Protein [E. coli] | 200-030/200-031/200-030-DC

Recombinant Human IL-6 Protein [E. coli] | 200-030/200-031/200-030-DC | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: IL6; HGF; HSF; BSF2; IL-6; IFNB2

Isotype: N/A

Application: N/A

Detection Range: The ED50 as determined by the dose-dependent stimulation of murine hybridoma B9 cells is in the range of ≤ 10 - 25 pg/ml.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: Interleukin 6 (IL-6) is a pleiotropic α-helical cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 activity is essential for the transition from acute inflammation to either acquired immunity or chronic inflammatory disease. It is secreted by multiple cell types as a 22 kDa-28 kDa phosphorylated and variably glycosylated molecule. Mature human IL6 is 183 amino acids (aa) in length and shares 41% aa sequence identity with mouse and rat IL-6. Alternate splicing generates several isoforms with internal deletions, some of which exhibit antagonistic properties. Human IL6 is equally active on mouse and rat cells. IL-6 induces signaling through a cell surface heterodimeric receptor complex composed of a ligand binding subunit (IL6 R) and a signal transducing subunit (gp130). IL-6 binds to IL-6 R, triggering IL-6 R association with gp130 and gp130 dimerization. Soluble forms of IL-6 R are generated by both alternate splicing and proteolytic cleavage. In a mechanism known as trans-signaling, complexes of soluble IL-6 and IL-6 R elicit responses from gp130expressing cells that lack cell surface IL-6 R. Trans-signaling enables a wider range of cell types to respond to IL-6, as the expression of gp130 is ubiquitous, while that of IL-6 R is predominantly restricted to hepatocytes, leukocytes, and lymphocytes. Soluble splice forms of gp130 block trans-signaling from IL-6/ IL-6 R but not from other cytokines that utilize gp130 as a co-receptor.

Purity Confirmation: > 98% by SDS-PAGE

Endotoxin: < 0.1 ng per µg (IEU/µg) of rh IL-6

Formulation: lyophilized

Storage Handling Stability: The lyophilized IL-6, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted IL-6 should be stored in working aliquots at -20°C.

Reconstituation: The lyophilized IL-6 should be reconstituted in water to a concentration not less than 100µg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.

Molecular Weight: 21.1 kDa

Lenght (aa): 186

Protein Sequence: MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

NCBI Gene ID: 3569