Recombinant Human PDGF-AB Protein [E. coli] | 200-053S/200-053/200-054

Recombinant Human PDGF-AB Protein [E. coli] | 200-053S/200-053/200-054 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: PDGFA; PDGF1; PDGF-A

Isotype: N/A

Application: N/A

Detection Range: The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-β. PDGFR-α is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-β interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids).

Purity Confirmation: > 95% by SDS-PAGE

Endotoxin: < 0.1 ng per ug of PDGF-AB

Formulation: lyophilized

Storage Handling Stability: The lyophilized PDGF-AB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AB is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles.

Reconstituation: Centrifuge vial prior to opening. The lyophilized PDGF-AB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.

Molecular Weight: 25.5 kDa

Lenght (aa): 126/110

Protein Sequence: Alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLACKCETVAAARPVT

NCBI Gene ID: 5154/5155