Recombinant Human PRAME Protein [E. coli] | 400-016

Recombinant Human PRAME Protein [E. coli] | 400-016 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: Melanoma antigen preferentially expressed in tumors; Opa-interacting protein 4; MAPE, OIP4

Isotype: N/A

Application: N/A

Detection Range: Positive control for WB.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: PRAME/MAPE/OIP4 is a germinal tissue-specific gene that is also expressed at high levels in haematological malignancies and solid tumors. The physiological functions of PRAME in normal and tumor cells are unknown, although a role in the regulation of retinoic acid signaling has been proposed. Sequence homology and structural predictions suggest that PRAME is related to the Leucine-rich repeat (LRR) family of proteins, which have diverse functions. PRAME, or „preferentially expressed antigen in melanoma”, was originally identified as a gene encoding a HLA-A24 restricted antigenic peptide presented to autologous tumor-specific cytotoxic T lymphocytes derived from a patient with melanoma. PRAME is synonymous with MAPE (melanoma antigen preferentially expressed in tumors) and OIP4 (OPA-interacting protein 4), and its expression profile defines it as a cancer-testis antigen. Cancer-testis antigens (CTAs) are encoded by non-mutated genes expressed at high levels in germinal tissues and tumors, but which are absent from or detected at low levels in other tissues. PRAME may be somewhat different to other cancer-testis antigens in that it shows some expression in normal tissues such as ovary, adrenal, placenta and endometrium. The C-terminus of human PRAME (amino acids 453-509) was also identified to bind Neisseria gonorrhoeae opacity factors, in this case the OPA-P protein. Thus PRAME is also known as OIP4 (OPA interacting protein), although the functional implications of the interaction are unknown.

Purity Confirmation: > 98 by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: The lyophilized human PRAME, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human PRAME should be stored in working aliquots at -20°C.

Reconstituation: Centrifuge vial prior to opening. Human PRAME should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C

Molecular Weight: 10.7 kDa

Lenght (aa): 106

Protein Sequence: MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI

NCBI Gene ID: 23532