209

Recombinant Human Prox-1 (fragment) Protein [E. coli] | 300-052

(No reviews yet) Write a Review
SKU:
209-300-052-GEN
NULL437.00

Description

Recombinant Human Prox-1 (fragment) Protein [E. coli] | 300-052 | Gentaur UK, US & Europe Distribution

Species: Human

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: PROX1; W117m

Isotype: N/A

Application: N/A

Detection Range: Control for Western Blotting. Biological activity not tested.

Species Reactivity/Cross reactivity: Human

Antigen: N/A

Description: Prox-1 is a homeobox gene and acts as a master switch for lymphatic endothelial phenotype. Expression of Prox-1 in blood endothelial cells induces expression of other lymphatic marker genes. Together with Podoplanin, Prox-1 can be used to reliably distinguish lympathic vessels from blood vessels. Prox1 is expressed in CNS, eye, pancreas, liver and heart, and it is one of the most specific and reliable markers for lymphatic endothelial cells. The highly conserved C-terminal part of the homeobox transcription factor Prox1 was produced in E. coli. It was not tested for activity and can be used as positive control e.g. in Western analysis.

Purity Confirmation: > 95% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20°C. Reconstituted Prox-1 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.

Reconstituation: Centrifuge vial prior to opening. The lyophilized Prox-1 should be reconstituted in water to a concentration not lower than 50 µg/ml.

Molecular Weight: 22.35 kDa

Lenght (aa): 192

Protein Sequence: MAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE

NCBI Gene ID: 5629

View AllClose

Additional Information

Size:
5 μg
View AllClose