Description
Recombinant Human VE-Statin/EGFL7 Protein [Insect cells] | 300-100 | Gentaur UK, US & Europe Distribution
Species: Human
Host / biotech: Insect cells
Comment: N/A
Label: His-Tag
Clone / Antibody feature: N/A
Subcategory: Cytokines & Growth Factors
Category: Recombinant Protein
Synonyms: EGFL7; NEU1; ZNEU1; VE-STATIN; RP11-251M1.2, NOTCH4-like protein,
Isotype: N/A
Application: WB
Detection Range: Testing under progress.
Species Reactivity/Cross reactivity: Human
Antigen: N/A
Description: EGFL7 (VE-Statin) is an ∼ 30 kDa secreted protein that contains an Emilin-like (EMI) domain (a multimerization motif), and two epidermal growth factor (EGF) domains, one of which binds calcium. Based on these domains, it has been hypothesized that EGFL7 may self-assemble like extracellular matrix (ECM) proteins and, thus, could incorporate into ECM. EGFL7 has been reported to stimulate cell adhesion as well as motility in a manner similar to ECM proteins. EGFL7 has been shown to be primarily expressed by developing ECs but also by primordial germ cells and some central nervous system neurons. Interestingly, EGFL7 expression markedly decreases in ECs in postnatal life, but can be strongly up-regulated after various tissue injuries that lead to increased angiogenic responses.
Purity Confirmation: > 95% by SDS-PAGE
Endotoxin: N/A
Formulation: lyophilized
Storage Handling Stability: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted EGFL7 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!
Reconstituation: The lyophilized human EGFL7 should be reconstituted in water to a concentration of not lower than 50µg/ml.
Molecular Weight: 22.75 kDa
Lenght (aa): 211
Protein Sequence: HHHHHHTEHAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
NCBI Gene ID: 51162