Recombinant Mouse I-TAC (CXCL11) Protein [E. coli] | M10-086S/M10-086

Recombinant Mouse I-TAC (CXCL11) Protein [E. coli] | M10-086S/M10-086 | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: CXCL11

Isotype: N/A

Application: N/A

Detection Range: Determined by its ability to chemoattract murine CXCR3 transfected HEK/293 cells using a concentration range of 10.0-100.0 ng/ml.

Species Reactivity/Cross reactivity: Human, Mouse, Monkey, Bacteria

Antigen: N/A

Description: I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.

Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 9.0 kDa

Lenght (aa): 79

Protein Sequence: FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

NCBI Gene ID: 56066