209

Recombinant Mouse TPO Protein [E. coli] | M10-087S/M10-087

(No reviews yet) Write a Review
SKU:
209-M10-087S/209-M10-087-GEN
NULL454.00 - NULL605.00

Description

Recombinant Mouse TPO Protein [E. coli] | M10-087S/M10-087 | Gentaur UK, US & Europe Distribution

Species: Mouse

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: TPO, Thrombopoietin, MGDF, Megakaryocyte colony-stimulating factor, c-MPL Ligand

Isotype: N/A

Application: N/A

Detection Range: The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be < 1.0 ng/ml, corresponding to a specific activity of > 1 x 106 units/mg.

Species Reactivity/Cross reactivity: Human, Mouse

Antigen: N/A

Description: TPO is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor and acts as an important regulator of circulating platelets. Human and murine TPO exhibits cross-species reactivity. Recombinant murine TPO is a fully biologically active 174 amino acid polypeptide (18.7 kDa), which contains the erythropoietin-like domain of the full length TPO protein.

Purity Confirmation: > 98% by SDS-PAGE & HPLC analyses

Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)

Formulation: lyophilized

Storage Handling Stability: N/A

Reconstituation: N/A

Molecular Weight: 18.7 kDa

Lenght (aa): 174

Protein Sequence: SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF

NCBI Gene ID: 22018

View AllClose