209

Recombinant Rat Podoplanin, soluble Protein [E. coli] | S01-R46

(No reviews yet) Write a Review
SKU:
209-S01-R46-GEN
NULL395.00

Description

Recombinant Rat Podoplanin, soluble Protein [E. coli] | S01-R46 | Gentaur UK, US & Europe Distribution

Species: Rat

Host / biotech: E. coli

Comment: N/A

Label: His-Tag

Clone / Antibody feature: N/A

Subcategory: Soluble Receptors

Category: Recombinant Protein

Synonyms: Pdpn; E11; Gp38; OTS-8; RTI40; T1-alpha

Isotype: N/A

Application: N/A

Detection Range: Testing in progress.

Species Reactivity/Cross reactivity: Rat

Antigen: N/A

Description: Podoplanin, also known as glycoprotein 38 (gp38), PA2.26 antigen, T1alpha (T1A), and aggrus, is a 38 kDa type I transmembrane sialoglycoprotein and member of the podoplanin family. Podoplanin is synthesized as a 172 amino acid (aa) precursor with a 22 aa signal sequence, a 119 aa extracellular domain (ECD), a 21 aa transmembrane region, and a short, 10 aa cytoplasmic tail. The ECD contains abundant Ser/Thr residues as potential sites for Oglycosylation, and the cytoplasmic region contains putative sites for kinase C and cAMP phosphorylation. Mouse Podoplanin shares 77% and 46% aa sequence identity with rat and human Podoplanin, respectively. Podoplanin is expressed on glomerular epithelial cells (podocytes), type I lung alveolar cells, lymphatic endothelial cells, and on numerous tumors including colorectal tumors, squamous cell carcinomas, testicular seminoma, and brain tumors. One study shows high expression of Podoplanin mRNA in placenta, lung, skeletal muscle, and heart, and weaker levels in brain, kidney, and liver. Podoplanin is the ligand for Ctype lectin like receptor 2 (CLEC2). Their association is dependent on sialic acid on Oglycans of Podoplanin. Through its association with CLEC2, Podoplanin induces platelet aggregation and tumor metastasis. Podoplanin is also necessary for lymphatic vessel formation, normal lung cell proliferation and alveolus formation at birth.

Purity Confirmation: > 98% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized

Storage Handling Stability: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted sPodoplanin should be stored in working aliquots at -20°C.

Reconstituation: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.

Molecular Weight: N/A

Lenght (aa): 120

Protein Sequence: GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTLEHHHHHH

NCBI Gene ID: 54320

View AllClose

Additional Information

Size:
5 μg
View AllClose