Recombinant Rat VEGF164 Protein [E. coli] | R20-067S/R20-067/R20-068

Recombinant Rat VEGF164 Protein [E. coli] | R20-067S/R20-067/R20-068 | Gentaur UK, US & Europe Distribution

Species: Rat

Host / biotech: E. coli

Comment: N/A

Label: N/A

Clone / Antibody feature: N/A

Subcategory: Cytokines & Growth Factors

Category: Recombinant Protein

Synonyms: vascular endothelial growth factor A; Vegfa; Vegf; VEGF164

Isotype: N/A

Application: N/A

Detection Range: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.

Species Reactivity/Cross reactivity: Rat

Antigen: N/A

Description: Rat Vascular Endothelial Growth Factor164 (VEGF164), a 19.23 kDa protein consisting of 164 amino acid residues, is produced as a homodimer. VEGF164 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF164 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF164 (Ala27-Arg190) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols

Purity Confirmation: > 95% by SDS-PAGE

Endotoxin: N/A

Formulation: lyophilized (freeze-dried)

Storage Handling Stability: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF164 should be stored in working aliquots at -20°C

Reconstituation: The lyophilized VEGF164 should be reconstituted in ddH2O to a concentration not lower than 50µg/ml.

Molecular Weight: 19.23 kDa

Lenght (aa): 164

Protein Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

NCBI Gene ID: 83785