Description
SARS-CoV-2 (COVID-19) ORF8 protein polyclonal antibody | 11-049 | Gentaur UK, US & Europe Distribution
Host: Rabbit
Reactivity: Virus
Homology: N/A
Immunogen: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Research Area: Infectious Disease, COVID-19
Tested Application: E
Application: Elisa:1:4000~1:8000
Specificiy: Recognizes SARS-CoV-2 ORF8 protein
Positive Control 1: N/A
Positive Control 2: N/A
Positive Control 3: N/A
Positive Control 4: N/A
Positive Control 5: N/A
Positive Control 6: N/A
Molecular Weight: N/A
Validation: N/A
Isoform: N/A
Purification: N/A
Clonality: Polyclonal
Clone: N/A
Isotype: IgG
Conjugate: Unconjugated
Physical State: Liquid
Buffer: PBS, pH7.4, containing 0.05% proclin300, 50% glycerol.
Concentration: N/A
Storage Condition: Use a manual defrost freezer and avoid repeated freeze thaw cycles. Store at 2 to 8 ˚C for one week. Store at -20 to -80 ˚C for twelve months from the date of receipt.
Alternate Name: Non-structural protein 8, ns8, ORF8 protein
User Note: Optimal dilutions for each application to be determined by the researcher.
BACKGROUND: N/A