SARS-CoV-2 (COVID-19) RBD Recombinant Protein | 10-078

SARS-CoV-2 (COVID-19) RBD Recombinant Protein | 10-078 | Gentaur UK, US & Europe Distribution

Tested Application: E

Application: ELISA

Tpredicted Molecular Weight: The predicted molecular mass is ~33 kDa.

Physical State: Liquid

Buffer: This recombinant protein is aseptically packaged and formulated in 0.01 M phosphate buffered saline (PBS) pH 7.2 - 7.4, 150 mM NaCl with no carrier protein, potassium, calcium or preservatives added.

Storage Condition: This recombinant protein may be stored as received at 2-8˚C for up to one month. For longer term storage, aseptically aliquot in working volumes without diluting and store at -80˚C. Avoid Repeated Freeze Thaw Cycles.

Alternate Name: N/A

Background: Zhou, P., Yang, X., Wang, X. et al. Nature 579, 270–273. 2020.

Shipping: Dry Ice

Disclaimer: Optimal dilutions/concentrations should be determined by the end user. The information provided is a guideline for product use. This product is for research use only.

Source: HEK293 cells

Species: SARS-CoV-2

By Source: Human Cells

By Species: Other

Fusion Tag: N/A

Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWN SNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGF QPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESN KKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCS

Bological Activity: N/A

Purity: >95% by SDS Page