Transferrin, Rat Plasma | 7543

Transferrin is a monomeric glycoprotein found in plasma at an average concentration of 250 mg/100ml. The specific iron-binding protein in plasma, it has a role in the transportation and distribution of iron among the body organs, in iron metabolism and in prevention of iron loss via the kidney. Stored in bone marrow as TF-bound iron, it also possesses bacteriostatic and fungistatic activity. Clinically, decreases in transferrin are observed in congenital disorders, newborns, inflammatory diseases, hypo-proteinemias and nephritic syndrome; increases are found in pregnancy, iron-deficiency anemias and inoculation hepatitis. Transferrin is required by all types of cells in cultures for maximal growth. It is, therefore, an important factor used in defined culture media.

7543 | Transferrin Rat Plasma DataSheet

Biomolecule/Target: Transferrin

Synonyms: Transferrin, Siderophilin, TF, DKFZp781D0156, PRO1557, PRO2086

Alternates names: Transferrin, Siderophilin, TF, DKFZp781D0156, PRO1557, PRO2086

Taglines: The specific iron-binding protein in plasma.

NCBI Gene ID #: 6360

NCBI Gene Symbol: CCL16

Gene Source: Rat

Accession #: O15467

Recombinant: No

Source: Rat Plasma

Purity by SDS-PAGEs: 97%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: N/A

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 80.0 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 20 mM Na phosphate, pH 7.4 and 150 mM NaCI.

Reconstitution Instructions: Reconstitute in sterile ddHO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ