Description
TREM1 is a receptor belonging to the Ig super family that is expressed on myeloid cells. This protein amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. Recombinant human TREM1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
7332 | TREM1 human recombinant DataSheet
Biomolecule/Target: TREM1
Synonyms: Triggering receptor expressed on myeloid cells 1, CD354, TREM-1
Alternates names: Triggering receptor expressed on myeloid cells 1, CD354, TREM-1
Taglines: Amplifies neutrophil and monocyte-mediated inflammatory responses
NCBI Gene ID #: 6360
NCBI Gene Symbol: CCL16
Gene Source: Human
Accession #: O15467
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs: 97%
Assay: SDS-PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: < 1.0 EU per 1 microgram of protein
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 23.3 kDa (209 aa, 21-205 aa + His Tag), confirmed by MALDI-TOF.
Concentration: 0.5 mg/ml
Appearance: Liquid
Physical form description: 0.5 mg/ml in 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 30% glycerol and 1 mM DTT.
Reconstitution Instructions: Reconstitute in sterile ddHO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNP NDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ