118

Annexin A1 antibody | 70R-1703

(No reviews yet) Write a Review
SKU:
118-70R-1703-GEN
Availability:
Usually ships in 5 working days
£1,470.00

Description

Annexin A1 antibody | 70R-1703 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Cell Biology

Short Description: Rabbit polyclonal Annexin A1 antibody raised against the N terminal of ANXA1

Immunogen: Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD

Host: Rabbit

Specificity: Annexin A1 antibody was raised against the N terminal of ANXA1

Cross Reactivity: Human

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Total IgG Protein A purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB, IHC

Bioactivity: N/A

Usage Recommendations: WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Assay Information: Annexin A1 Blocking Peptide, catalog no. 33R-9944, is also available for use as a blocking control in assays to test for specificity of this Annexin A1 antibody

View AllClose

Additional Information

Size:
100 uL
View AllClose