ARG1, Human Recombinant | P1032

ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.

P1032 | ARG1 Human Recombinant DataSheet

Biomolecule/Target: ARG1

Synonyms: Arginase-1, Liver-type arginase, Type I arginase, ARG1

Alternates names: Arginase-1, Liver-type arginase, Type I arginase, ARG1

Taglines: N/A

NCBI Gene ID #: 383

NCBI Gene Symbol: ARG1

Gene Source: Human

Accession #: P05089

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs:

Assay: SDS PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: N/A

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 34.7 kDa

Concentration: N/A

Appearance: Liquid

Physical form description: Liquid

Reconstitution Instructions: 20mM Tris, 150mM NaCl, 20% Glycerol, 1mM DTT, pH 7.4.

Amino acid sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEHHHHHH