26
ARG1, Human Recombinant | P1032
- SKU:
- 26-P1032-GEN
- Availability:
- Usually shipped in 5 working days
Description
ARG1 is a member of the ureohydrolase family of enzymes. ARG1 can catalyze the hydrolysis of arginine to ornithine and urea. In the urea cycle, ARG1 catalyzes the fifth and final step, a series of biochemical reactions in mammals during which the body disposes of harmful ammonia. ARG1 is a cytosolic enzyme and expressed widely in the liver as part of the urea cycle. Inherited deficiency of this ARG1 causes argininemia, which is an autosomal recessive disorder characterized by hyperammonemia.
P1032 | ARG1 Human Recombinant DataSheet
Biomolecule/Target: ARG1
Synonyms: Arginase-1, Liver-type arginase, Type I arginase, ARG1
Alternates names: Arginase-1, Liver-type arginase, Type I arginase, ARG1
Taglines: N/A
NCBI Gene ID #: 383
NCBI Gene Symbol: ARG1
Gene Source: Human
Accession #: P05089
Recombinant: Yes
Source: E. coli
Purity by SDS-PAGEs:
Assay: SDS PAGE
Purity: N/A
Assay #2: N/A
Endotoxin Level: N/A
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 34.7 kDa
Concentration: N/A
Appearance: Liquid
Physical form description: Liquid
Reconstitution Instructions: 20mM Tris, 150mM NaCl, 20% Glycerol, 1mM DTT, pH 7.4.
Amino acid sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEHHHHHH