Frequently bought together:
Additional Information
Size: |
100 µg |
Other Name: |
Ataxin 1 Antibody: APC |
Target: |
Ataxin 1 |
Conjugate: |
APC |
Research Area: |
Neuroscience, Neurodegeneration, Cell Signaling, Epigenetics and Nuclear Signaling |
Alternative Name(s): |
Ataxin-1 Antibody, ATX1 Antibody, Atxn1 Antibody, D6S504E Antibody, OTTHUMP00000016065 Antibody, SCA1 Antibody, Spinocerebellar ataxia type 1 protein Antibody |
Product Type: |
Monoclonal Antibody |
Clone Number: |
S76-8 |
Immunogen: |
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
Immunogen Species: |
Mouse |
Applications: |
WB, IHC, ICC/IF, IP |
Host: |
Mouse |
Isotype: |
IgG2b |
Species Reactivity: |
Human, Mouse, Rat |
Antibody Dilution: |
WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user. |
Purification: |
Protein G Purified |
Storage Buffer: |
PBS pH 7.4, 50% glycerol, 0.1% sodium azide |
Concentration: |
1 mg/ml |
Specificity: |
Detects ~85kDa. |
Storage: |
-20ºC |
Shipping: |
Blue Ice or 4ºC |
Certificate of Analysis: |
1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody. |
Cellular Localization: |
Cytoplasm | Nucleus |
Accession Number: |
NP_001186233.1 |
Gene ID: |
20238 |
Swiss-Prot: |
P54254 |
Field of Use: |
Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only. |