BNP, human | 4875

Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and HO balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.

4875 | BNP human DataSheet

Biomolecule/Target: N/A

Synonyms: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide

Alternates names: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide, Gamma-brain natriuretic peptide

Taglines: Binds and activates the atrial natriuretic factor receptors

NCBI Gene ID #: 8850

NCBI Gene Symbol: PCAF

Gene Source: Human

Accession #: Q92831

Recombinant: No

Source: Synthetic

Purity by SDS-PAGEs: 95%

Assay: SDS-PAGE

Purity: 98%

Assay #2: HPLC

Endotoxin Level: N/A

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 3.464 kDa

Concentration: N/A

Appearance: Lyophilized protein

Physical form description: Lyophilized with no additives

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH