Description
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. It helps to restore the body's salt and HO balance and improves heart function. B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.
Biomolecule/Target: N/A
Synonyms: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide
Alternates names: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide, Gamma-brain natriuretic peptide
Taglines: Binds and activates the atrial natriuretic factor receptors
NCBI Gene ID #: 8850
NCBI Gene Symbol: PCAF
Gene Source: Human
Accession #: Q92831
Recombinant: No
Source: Synthetic
Purity by SDS-PAGEs: 95%
Assay: SDS-PAGE
Purity: 98%
Assay #2: HPLC
Endotoxin Level: N/A
Activity (Specifications/test method): N/A
Biological activity: N/A
Results: N/A
Binding Capacity: N/A
Unit Definition: N/A
Molecular Weight: 3.464 kDa
Concentration: N/A
Appearance: Lyophilized protein
Physical form description: Lyophilized with no additives
Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.
Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH