118
C20ORF18 antibody | 70R-1161
- SKU:
- 118-70R-1161-GEN
- Availability:
- Usually ships in 5 working days
Description
C20ORF18 antibody | 70R-1161 |
Activity Code: ACTIVE
Product Type: Primary Antibodies
Product Subtype: Purified Polyclonal Antibodies
Research Area: Protein Modification & Stress Response
Short Description: Rabbit polyclonal C20ORF18 antibody raised against the middle region of C20Orf18
Immunogen: C20ORF18 antibody was raised using the middle region of C20Orf18 corresponding to a region with amino acids AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRS
Host: Rabbit
Specificity: C20ORF18 antibody was raised against the middle region of C20Orf18
Cross Reactivity: Human, Mouse
Isotype: N/A
IClone: N/A
Species: N/A
Residues: N/A
Tag/conjugate: N/A
Protein Type: N/A
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: Total IgG Protein A purified
Source: N/A
Concentration: N/A
Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB
Bioactivity: N/A
Usage Recommendations: WB: 1.25 ug/ml
Assay Information: C20ORF18 Blocking Peptide, catalog no. 33R-1633, is also available for use as a blocking control in assays to test for specificity of this C20ORF18 antibody