118
CA2 Blocking Peptide | 33R-8709
- SKU:
- 118-33R-8709-GEN
- Availability:
- Usually ships in 5 working days
Description
CA2 Blocking Peptide | 33R-8709 |
Activity Code: ACTIVE
Product Type: Proteins
Product Subtype: Blocking Peptides
Research Area: DNA & RNA
Short Description: A synthetic peptide for use as a blocking control in assays to test for specificity of CA2 antibody, catalog no. 70R-9979
Immunogen: N/A
Host: N/A
Specificity: N/A
Cross Reactivity: N/A
Isotype: N/A
IClone: N/A
Species: N/A
Residues: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH
Tag/conjugate: N/A
Protein Type: Synthetic
Expression System: N/A
Grade & Purity: N/A
Methode of Purification: N/A
Source: N/A
Concentration: N/A
Form & Buffer: Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage: Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Shipping Information: *Blue Ice*
Applications: WB, IHC
Bioactivity: N/A
Usage Recommendations: N/A
Assay Information: N/A