26

CCR6 Antibody | A2299

(No reviews yet) Write a Review
SKU:
26-A2299-GEN
Availability:
Usually shipped in 5 working days
£1,168.00 - £1,628.00

Description

C-C chemokine receptor type 6 (CCR6) is the receptor for the CCL20 chemokine as well as beta-defensins. CCR6 is responsible for the chemotaxis of dendritic cells as well as B and T lymphocytes, inflammation and immune responses, and wound healing. CCR6 has been associated with Crohn's disease, and is also implicated in tumor progression due to recruitment of macrophages and other immune cells to the tumor microenvironment, particularly in gastrointestinal malignancies such as colorectal cancer.

A2299 | CCR6 Antibody DataSheet

Antibody Target: Human CCR6

Target Alternative Name: CCR6; BN-1; C-C CKR-6; CC-CKR-6; CCR-6; CD196; CKR-L3; CKRL3; CMKBR6; DCR2; DRY6; GPR29; GPRCY4; STRL22

Tag Line: An important mediator of immune cell differentiation and inflammatory responses

Category: GM-CSF

Host: Rabbit

Isotype: Rabbit IgG

Species Reactivities: Human

Immunogen Sequence: VTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAGRYSENISRQTSETADNDNASSFTM

Accession #: P51684

Gene ID: 1235

Appearance: Liquid

Form: Rabbit polyclonal

Concentration:

Formulation: In PBS with 0.02% sodium azide, 50% glycerol, pH 7.3

Purification: Affinity purified

Application: Western Blotting

Positive Control:

Application And Usages:

Country of Animal Origin: USA

Country of Manufacture: USA

Usage: For Research Use Only! Not to be used in humans.

Handling: The antibody solution should be gently mixed before use.

Western Blot Verified: TRUE

Immunocytochemistry Verified:

Immunofluorescence Verified: FALSE

Immunoprecipitation Verified: FALSE

FACS Verified:

ELISA Verified: FALSE

ChIP Verified: FALSE

Dot Blot Verified: FALSE

Flow Cytometry Verified: FALSE

View AllClose

Additional Information

Storage Condition:
-20°C
Shipping Condition:
Gel Pack
Shelf Life:
12 months
View AllClose