118

Epsilon TubuLin 1 antibody | 70R-5639

(No reviews yet) Write a Review
SKU:
118-70R-5639-GEN
Availability:
Usually ships in 5 working days
NULL810.00

Description

Epsilon TubuLin 1 antibody | 70R-5639 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Cell Cycle & Cell Death

Short Description: Rabbit polyclonal Epsilon TubuLin 1 antibody raised against the middle region of TUBE1

Immunogen: Epsilon TubuLin 1 antibody was raised using the middle region of TUBE1 corresponding to a region with amino acids PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG

Host: Rabbit

Specificity: Epsilon TubuLin 1 antibody was raised against the middle region of TUBE1

Cross Reactivity: Human

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Affinity purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB

Bioactivity: N/A

Usage Recommendations: WB: 1 ug/ml

Assay Information: Epsilon TubuLin 1 Blocking Peptide, catalog no. 33R-7351, is also available for use as a blocking control in assays to test for specificity of this Epsilon TubuLin 1 antibody

View AllClose

Additional Information

Size:
100 uL
View AllClose