FAM53C antibody | 70R-3662

FAM53C antibody | 70R-3662 |

Activity Code: ACTIVE

Product Type: Primary Antibodies

Product Subtype: Purified Polyclonal Antibodies

Research Area: Signal Transduction

Short Description: Rabbit polyclonal FAM53C antibody raised against the N terminal of FAM53C

Immunogen: FAM53C antibody was raised using the N terminal of FAM53C corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG

Host: Rabbit

Specificity: FAM53C antibody was raised against the N terminal of FAM53C

Cross Reactivity: Human

Isotype: N/A

IClone: N/A

Species: N/A

Residues: N/A

Tag/conjugate: N/A

Protein Type: N/A

Expression System: N/A

Grade & Purity: N/A

Methode of Purification: Affinity purified

Source: N/A

Concentration: N/A

Form & Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Storage: Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

Shipping Information: *Blue Ice*

Applications: WB

Bioactivity: N/A

Usage Recommendations: WB: 1 ug/ml

Assay Information: FAM53C Blocking Peptide, catalog no. 33R-8648, is also available for use as a blocking control in assays to test for specificity of this FAM53C antibody