Human CellExp™ HGF, Human Recombinant | 6456

Hepatocyte Growth Factor (HGF) is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis.

6456 | Human CellExp HGF Human Recombinant DataSheet

Biomolecule/Target: N/A

Synonyms: Human Cellexp Human Recombinant HGF

Alternates names: NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide, Gamma-brain natriuretic peptide

Taglines: A growth factor regulating cell growth, cell motility, and morphogenesis

NCBI Gene ID #: 4879

NCBI Gene Symbol: BNP

Gene Source: Human

Accession #: P16860

Recombinant: Yes

Source: Synthetic

Purity by SDS-PAGEs: 98%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: < 1.0 EU per 1 g of protein

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 3.464 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized in solution of 10 mM Tris-HCl, pH 7.4, with 1 M NaCl.

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH