26

Human CellExp™ HVEM/TNFRSF14, human recombinant | 7466

(No reviews yet) Write a Review
SKU:
26-7466-GEN
Availability:
Usually shipped in 5 working days
zł2,766.00 - zł6,696.00

Description

Herpesvirus entry mediator (HVEM), also known as TNFRSF14, TR2 (TNF receptor like molecule) and ATAR (another TRAF associated receptor), is a type I membrane protein belonging to the TNF/NGF receptor superfamily. HVEM expression has been detected in peripheral blood T cells, B cells, monocytes and in various tissues enriched in lymphoid cells. The extracellular domain of HVEM has been shown to interact directly with the herpes simplex virus envelope glycoprotein D (gD). Two TNF superfamily ligands, including the secreted TNF (lymphotoxin ) and the membrane protein LIGHT (lymphotoxins, exhibits inducible expression, and competes with HSV glycoprotein D for HVEM, a receptor expressed by T lymphocytes), have been shown to be the cellular ligands for HVEM. Besides HVEM, LIGHT can also interact with LTR, the receptor for lymphotoxin heterotrimer. The role of the HVEM LIGHT /LT receptor ligand pair in immune function and herpesvirus pathobiology remains to be elucidated.

7466 | Human CellExp HVEM/TNFRSF14 human recombinant DataSheet

Biomolecule/Target: HVEM/TNFRSF14

Synonyms: TNFRSF14, ATAR, HVEA, HVEM, LIGHTR, TR2, Tumor necrosis factor receptor superfamily member 14, Herpesvirus entry mediator.

Alternates names: Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF

Taglines: A type I membrane protein belonging to the TNF/NGF receptor superfamily

NCBI Gene ID #: 2764

NCBI Gene Symbol: GMFB

Gene Source: Human

Accession #: P60983

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 98%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: <1 EU/g by LAL method

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 17.0 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in 50 mM tris, 100 mM glycine, pH 7.0. Normally Mannitol or Trehalose is added as protectants before lyophilization.

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH.

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose