26

Human CellExp™ LILRB4 / CD85k / ILT3, Cynomolgus Recombinant | P1187

(No reviews yet) Write a Review
SKU:
26-P1187-GEN
Availability:
Usually shipped in 5 working days
zł2,124.00 - zł5,568.00

Description

Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4) is also known as CD85 antigen-like family member K (CD85K), Immunoglobulin-like transcript 3 (ILT-3), Leukocyte immunoglobulin-like receptor 5 (LIR-5), Monocyte inhibitory receptor HM18, which belongs to the leukocyte immunoglobulin-like receptor (LIR) family. LILRB4 / CD85K contains 2 Ig-like C2-type (immunoglobulin-like) domains. CD85K is detected in monocytes, macrophages, dendritic cells, lung, natural killer cells and B-cells. LILRB4 / CD85K is receptor for class I MHC antigens. CD85K recognizes a broad spectrum of HLA-A, HLA-B, HLA-C and HLA-G alleles, involved in the down-regulation of the immune response and the development of tolerance. LILRB4 interferes with TNFRSF5-signaling and NF-kappa-B up-regulation and inhibits receptor-mediated phosphorylation of cellular proteins and mobilization of intracellular calcium ions.

P1187 | Human CellExp LILRB4 / CD85k / ILT3 Cynomolgus Recombinant DataSheet

Biomolecule/Target: LILRB4

Synonyms: LILRB4, ILT3, LIR5, CD85K, HM18

Alternates names: Leukemia Inhibitory Factor, Differentiation-stimulating factor, D factor, Melanoma-derived LPL inhibitor, INN=Emfilermin

Taglines: Receptor for class I MHC antigens

NCBI Gene ID #: 16878

NCBI Gene Symbol: LIF

Gene Source: Mouse

Accession #: Q3U1H5

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 95%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: < 1.0 EU per/g

Activity (Specifications/test method): N/A

Biological activity: N/A

Results: N/A

Binding Capacity: Immobilized Human ANGPTL7, His Tag at 5 g/mL (100 L/well) can bind Cynomolgus LILRB4, Fc Tag with a linear range of 10-156 ng/mL.

Unit Definition: N/A

Molecular Weight: 20.0 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in PBS pH 7.4. Generally 5-8% Mannitol or Trehalose is added as a protectant before lyophilization.

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile HO to a concentration 100 µg/ml. This solution can then be diluted into other aqueous buffers.

Amino acid sequence: MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose