26

Human CellExp™ PD-1 /PDCD1, C-Fc Tag, human recombinant | 7500

(No reviews yet) Write a Review
SKU:
26-7500-GEN
Availability:
Usually shipped in 5 working days
£1,022.00 - £2,644.00

Description

Programmed cell death protein 1 (PD-1) is also known as CD279 and PDCD1, is a type I membrane protein and is a member of the extended CD28/CTLA-4 family of T cell regulators. PDCD1 is expressed on the surface of activated T cells, B cells, macrophages, myeloid cells and a subset of thymocytes. PD-1 has two ligands, PD-L1 and PD-L2, which are members of the B7 family. PD-L1 is expressed on almost all murine tumor cell lines, including PA1 myeloma, P815 mastocytoma, and B16 melanoma upon treatment with IFN-. PD-L2 expression is more restricted and is expressed mainly by DCs and a few tumor lines. PD1 inhibits the T-cell proliferation and production of related cytokines including IL-1, IL-4, IL-10 and IFN- by suppressing the activation and transduction of PI3K/AKT pathway. In addition, coligation of PD1 inhibits BCR-mediating signal by dephosphorylating key signal transducer. In vitro, treatment of anti-CD3 stimulated T cells with PD-L1-Ig results in reduced T cell proliferation and IFN- secretion. Monoclonal antibodies targeting PD-1 that boost the immune system are being developed for the treatment of cancer. This protein is suitable for use in protein studies such as protein structure analysis and protein-protein interactions. It can also be used as an immunogen, as a protein standard, or in cell biology research applications.

7500 | Human CellExp PD-1 /PDCD1 C-Fc Tag human recombinant DataSheet

Biomolecule/Target: PD-1/PDCD1

Synonyms: PDCD1, PD1, CD279, SLEB2, hPD-1, hPD-l

Alternates names: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.

Taglines: Inhibits the T-cell proliferation and production of IL-1, IL-4, IL-10 and IFN- by suppressing the activation and transduction of PI3K/AKT pathway.

NCBI Gene ID #: 22339

NCBI Gene Symbol: VEGFA

Gene Source: Mouse

Accession #: Q00731

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 97%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: <1 EU/g by LAL method

Activity (Specifications/test method): N/A

Biological activity: The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/ml.

Results: 1-5 ng/ml

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 28.2 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in 50 mM Tris, 100 mM glycine, pH 7.5. Normally Mannitol or Trehalose is added as protectants before lyophilization.

Reconstitution Instructions: Reconstitute the lyophilized product with sterile HO at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions

Amino acid sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose