26

Human CellExp™ PD-1 /PDCD1, C-Fc Tag, mouse recombinant | 7503

(No reviews yet) Write a Review
SKU:
26-7503-GEN
Availability:
Usually shipped in 5 working days
NULL511.00 - NULL1,322.00

Description

Programmed cell death protein 1 (PD-1) is also known as CD279 and PDCD1, is a type I membrane protein and is a member of the extended CD28/CTLA-4 family of T cell regulators. PDCD1 is expressed on the surface of activated T cells, B cells, macrophages, myeloid cells and a subset of thymocytes. PD-1 has two ligands, PD-L1 and PD-L2, which are members of the B7 family. PD-L1 is expressed on almost all murine tumor cell lines, including PA1 myeloma, P815 mastocytoma, and B16 melanoma upon treatment with IFN-. PD-L2 expression is more restricted and is expressed mainly by DCs and a few tumor lines. PD1 inhibits the T-cell proliferation and production of related cytokines including IL-1, IL-4, IL-10 and IFN- by suppressing the activation and transduction of PI3K/AKT pathway. In addition, coligation of PD1 inhibits BCR-mediating signal by dephosphorylating key signal transducer. In vitro, treatment of anti-CD3 stimulated T cells with PD-L1-Ig results in reduced T cell proliferation and IFN- secretion. Monoclonal antibodies targeting PD-1 that boost the immune system are being developed for the treatment of cancer. This protein is suitable for use in protein studies such as protein structure analysis and protein-protein interactions. It can also be used as an immunogen, as a protein standard, or in cell biology research applications.

7503 | Human CellExp PD-1 /PDCD1 C-Fc Tag mouse recombinant DataSheet

Biomolecule/Target: PD-1/PDCD1

Synonyms: PD, PD 1, PD 1 protein, PD 1 recombinant protein, mouse PD 1 protein, mouse recombinant PD 1 protein, mouse recombinant PD 1, mouse PD 1, recombinant PD 1, Human cell expressed PD 1, Human cell expressed PD 1 protein, Human cell expressed recombinant PD 1, Human cell expressed recombinant PD 1 protein, PD, PD-1, PD-1 protein, PD-1 recombinant protein, mouse PD-1 protein, mouse recombinant PD-1 protein, mouse recombinant PD-1, mouse PD-1, recombinant PD-1, Human cell expressed PD-1, Human cell expressed PD-1 protein, Human cell expressed recombinant PD-1, Human cell expressed recombinant PD-1 protein, PD, PD1, PD1 protein, PD1 recombinant protein, mouse PD1 protein, mouse recombinant PD1 protein, mouse recombinant PD1, mouse PD1, recombinant PD1, Human cell expressed PD1, Human cell expressed PD1 protein, Human cell expressed recombinant PD1, Human cell expressed recombinant PD1 protein, PD1, PDCD1, PD1, CD279, SLEB2, hPD-1, hPD-l, October-RP-14, PDCD, PDCD 1, PDCD 1 protein, PDCD 1 recombinant protein, mouse PDCD 1 protein, mouse recombinant PDCD 1 protein, mouse recombinant PDCD 1, mouse PDCD 1, recombinant PDCD 1, Human cell expressed PDCD 1, Human cell expressed PDCD 1 protein, Human cell expressed recombinant PDCD 1, Human cell expressed recombinant PDCD 1 protein, PDCD, PDCD-1, PDCD-1 protein, PDCD-1 recombinant protein, mouse PDCD-1 protein, mouse recombinant PDCD-1 protein, mouse recombinant PDCD-1, mouse PDCD-1, recombinant PDCD-1, Human cell expressed PDCD-1, Human cell expressed PDCD-1 protein, Human cell expressed recombinant PDCD-1, Human cell expressed recombinant PDCD-1 protein, PDCD, PDCD1, PDCD1 protein, PDCD1 recombinant protein, mouse PDCD1 protein, mouse recombinant PDCD1 protein, mouse recombinant PDCD1, mouse PDCD1, recombinant PDCD1, Human cell expressed PDCD1, Human cell expressed PDCD1 protein, Human cell expressed recombinant PDCD1, Human cell expressed recombinant PDCD1 protein, PDCD1

Alternates names: Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.

Taglines: Inhibits the T-cell proliferation and production of IL-1, IL-4, IL-10 and IFN- by suppressing the activation and transduction of PI3K/AKT pathway.

NCBI Gene ID #: 22339

NCBI Gene Symbol: VEGFA

Gene Source: Mouse

Accession #: Q00731

Recombinant: Yes

Source: E. coli

Purity by SDS-PAGEs: 97%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: <1 EU/g by LAL method

Activity (Specifications/test method): N/A

Biological activity: The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/ml.

Results: 1-5 ng/ml

Binding Capacity: N/A

Unit Definition: N/A

Molecular Weight: 28.2 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in 50 mM Tris, 100 mM glycine, pH 7.5. Normally Mannitol or Trehalose is added as protectants before lyophilization.

Reconstitution Instructions: Reconstitute the lyophilized product with sterile HO at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions

Amino acid sequence: MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose