26

Human CellExp™ VEGF110, Human Recombinant | P1258

(No reviews yet) Write a Review
SKU:
26-P1258-GEN
Availability:
Usually shipped in 5 working days
£1,660.00

Description

Vascular endothelial growth factor (VEGF), also known as vascular permeability factor (VPF) and VEGF-A, and is a member of the platelet-derived growth factor (PDGF)/vascular endothelial growth factor (VEGF) family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. Alternatively spliced isoforms of 110,121,145,165,183,189 and 206 amino acids in length are expressed in humans.

P1258 | Human CellExp VEGF110 Human Recombinant DataSheet

Biomolecule/Target: VEGF110

Synonyms: RP1-261G23.1, MGC70609, MVCD1, VEGFA, VPF

Alternates names: RP1-261G23.1, MGC70609, MVCD1, VEGFA, VPF

Taglines: A signaling protein involved in both vasculogenesis and angiogenesis

NCBI Gene ID #: 3576

NCBI Gene Symbol: IL8

Gene Source: Human

Accession #: P10145

Recombinant: Yes

Source: HEK293 cells

Purity by SDS-PAGEs: 98%

Assay: SDS-PAGE

Purity: 95%

Assay #2: HPLC

Endotoxin Level: < 1.0 EU per/g

Activity (Specifications/test method): Measured by its binding ability in a functional ELISA.

Biological activity: N/A

Results: N/A

Binding Capacity: Immobilized Human VEGF110 at 2 g/mL (100 L/well) can bind VEGFR1/R2-Fc with a linear range of 1-10 ng/mL. Immobilized Human VEGF110 at 2 g/mL (100 L/well) can bind Human VEGF R1 Protein, His Tag with a linear range of 3-100 ng/mL

Unit Definition: N/A

Molecular Weight: 12.6 kDa

Concentration: N/A

Appearance: Lyophilized

Physical form description: Lyophilized from 0.22 m filtered solution in PBS, pH7.4. Generally Trehalose is added as a protectant before lyophilization.

Reconstitution Instructions: Centrifuge the vial prior to opening. Reconstitute in sterile deionized water.

Amino acid sequence: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose