740

Human Glucagon like peptide 2 (GLP2) ELISA Kit | AE62821HU

(No reviews yet) Write a Review
SKU:
740-AE62821HU
Availability:
Usually ships in 5 working days
€1,830.00 - €3,213.00

Description

Human Glucagon like peptide 2 (GLP2) ELISA Kit | AE62821HU | Gentaur UK, US & Europe Distribution

Species Reactivity: Human (Homo sapiens)

Abbreviation: GLP2

Alternative Name: N/A

Application: ELISA

Range: 123.5-10000 pg/mL

Sensitivity: 52.1 pg/mL

Intra-Assay: ≤6.0%

Inter-Assay: ≤10.1%

Recovery: 1, 09

Sample Type: Serum, Plasma, Other biological fluids

Detection Method: Sandwich

Analysis Method : Quantitive

Test Principale: This assay employs a two-site sandwich ELISA to quantitate GLP2 in samples. An antibody specific for GLP2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGLP2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for GLP2 is added to the wells. After washing, Streptavidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GLP2 bound in the initial step. The color development is stopped and the intensity of the color is measured.

Product Overview: GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1) . GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.

Stability: The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calculated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C) .

View AllClose