26

Human Recombinant GSTP1 | 6347

(No reviews yet) Write a Review
SKU:
26-6347-GEN
Availability:
Usually shipped in 5 working days
£1,742.00
Frequently bought together:

Description

Glutathione S-transferase P is an enzyme that in humans is encoded by the GSTP1 gene. Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. The glutathione S-transferase pi gene (GSTP1) is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.

6347 | Human Recombinant GSTP1 DataSheet

Biomolecule/Target: N/A

Synonyms: Human Recombinant GSTP1

Alternates names: Glutathione S-transferase P, DFN7, FAEES3, GST3, PI

Taglines: Plays a role in detoxification of electrophilic compounds

NCBI Gene ID #: 3603

NCBI Gene Symbol: IL16

Gene Source: Human

Accession #: Q14005

Recombinant: Yes

Source: E. Coli

Purity by SDS-PAGEs: 98%

Assay: SDS-PAGE

Purity: N/A

Assay #2: N/A

Endotoxin Level: < 1.0 EU per 1 g of protein (determined by LAL method).

Activity (Specifications/test method): N/A

Biological activity: Specific activity is 20 U/mg

Results: N/A

Binding Capacity: N/A

Unit Definition: One unit of the human recombinant GSTP1 is defined as the amount of enzyme that conjugates 1.0 µmole of 1-chloro-2, 4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.

Molecular Weight: 27.6 kDa

Concentration: 2 mg/ml

Appearance: Liquid

Physical form description: 2.0 mg/ml solution in 30% glycerol without additives.

Reconstitution Instructions: N/A

Amino acid sequence: MGSSHHHHHHSSGLVPRGSHMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

View AllClose

Additional Information

Storage:
-20°C
Shipping:
Gel Pack
Shelf Life:
12 months
View AllClose